Protein Info for ABIE53_004053 in Paraburkholderia graminis OAS925
Annotation: 6-phosphogluconolactonase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 39% identical to 6PGL_YERE8: 6-phosphogluconolactonase (pgl) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
KEGG orthology group: K07404, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 74% identity to bac:BamMC406_5886)Predicted SEED Role
"hypothetical protein, not 6-phosphogluconolactonase"
MetaCyc Pathways
- superpathway of glucose and xylose degradation (16/17 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
- Entner-Doudoroff pathway I (9/9 steps found)
- pentose phosphate pathway (8/8 steps found)
- heterolactic fermentation (15/18 steps found)
- pentose phosphate pathway (oxidative branch) I (3/3 steps found)
- formaldehyde oxidation I (3/6 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 3.1.1.31
Use Curated BLAST to search for 3.1.1.31
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (365 amino acids)
>ABIE53_004053 6-phosphogluconolactonase (Paraburkholderia graminis OAS925) MSVSAVSRAVAILLAGVTMCATVHASTYAYVSNADSQDISVFSLDKSNGALKPVETVSVG GTVMPMAFSPNHLRLYAGLRSKPFRVVSFAVSPLDGRLTELGKAPLAESMAYVSTDASGR YLFSASYGGNLLAVNGIGANGVAGDVQQIVKTGPMAHAIRNAPDNRYVFASVLGADAWLR LKFDAANGALTQDAAPAYSLPAKSGPRHFVFSPDERFVYLIDELDGKLHVLAFDKQRDAV KPVQTVSILPPNFSGDKPWGADVHITPDGRFVYASERTSSTLAAYRVDRASGKLTRIGTY PTEKQPRGFNIDPSGNYLLAVGQLSTNLSAYRINRETGALSALGQYPVGKGANWIEIVEF NGSND