Protein Info for ABIE53_004053 in Paraburkholderia graminis OAS925

Annotation: 6-phosphogluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF10282: Lactonase" amino acids 29 to 355 (327 residues), 273 bits, see alignment E=4.1e-85

Best Hits

Swiss-Prot: 39% identical to 6PGL_YERE8: 6-phosphogluconolactonase (pgl) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K07404, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 74% identity to bac:BamMC406_5886)

Predicted SEED Role

"hypothetical protein, not 6-phosphogluconolactonase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.31

Use Curated BLAST to search for 3.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>ABIE53_004053 6-phosphogluconolactonase (Paraburkholderia graminis OAS925)
MSVSAVSRAVAILLAGVTMCATVHASTYAYVSNADSQDISVFSLDKSNGALKPVETVSVG
GTVMPMAFSPNHLRLYAGLRSKPFRVVSFAVSPLDGRLTELGKAPLAESMAYVSTDASGR
YLFSASYGGNLLAVNGIGANGVAGDVQQIVKTGPMAHAIRNAPDNRYVFASVLGADAWLR
LKFDAANGALTQDAAPAYSLPAKSGPRHFVFSPDERFVYLIDELDGKLHVLAFDKQRDAV
KPVQTVSILPPNFSGDKPWGADVHITPDGRFVYASERTSSTLAAYRVDRASGKLTRIGTY
PTEKQPRGFNIDPSGNYLLAVGQLSTNLSAYRINRETGALSALGQYPVGKGANWIEIVEF
NGSND