Protein Info for ABIE53_004047 in Paraburkholderia graminis OAS925

Annotation: L-alanine-DL-glutamate epimerase-like enolase superfamily enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02746: MR_MLE_N
  • amino acids 39 to 133 (95 residues), 64.6 bits, E=9.8e-22
• PF13378: MR_MLE_C
  • amino acids 155 to 365 (211 residues), 211.4 bits, E=1.4e-66

Best Hits

KEGG orthology group: None (inferred from 76% identity to bpy:Bphyt_6386)

Predicted SEED Role

"Mandelate racemase (EC 5.1.2.2)" (EC 5.1.2.2)

MetaCyc Pathways

• mandelate degradation I (2/5 steps found)
• 4-hydroxymandelate degradation (2/6 steps found)
• mandelate degradation to acetyl-CoA (10/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (19/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.2.2

Protein Sequence (373 amino acids)

>ABIE53_004047 L-alanine-DL-glutamate epimerase-like enolase superfamily enzyme (Paraburkholderia graminis OAS925)
MSKAASARGGSQLPVSAVRASAYRIPSHAPESDGTFEWNATTLVVVEVDAGGQTGIGYTY
SDSSIVALIANTLSPCVTGEDVADIRAHWNRMQRQVRNLGRAGLAATAISAIDCALWDAK
AKLLGVPLVQLLGAARESVPLYGSGGFTTYNDRQLRDQLAGWVERDGCRWVKMKIGSQPH
KDQARVKAAREAIGDAGLFVDANGAFSPREALYHARQFEAQQVAWFEEPVSSDDAAGLRF
VREHAPSGMDIAAGEYAYTSDDFRTLLAEGSVDVLQADVSRCGGITGFLQAAALCDAFHM
PLSAHCAPALHLHVACAVPRLRHQEWFHDHVRIEAMLFDGAPRAHDGVIAPDLSRPGCGL
AFKHEDAAQYFVA