Protein Info for ABIE53_004037 in Paraburkholderia graminis OAS925

Annotation: tetratricopeptide (TPR) repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13432: TPR_16
  • amino acids 114 to 171 (58 residues), 29.8 bits, 5e-10
  • amino acids 176 to 240 (65 residues), 38.5 bits, E=9.2e-13
  • amino acids 213 to 273 (61 residues), 28.9 bits, 9.4e-10
  • amino acids 284 to 340 (57 residues), 27.3 bits, 2.9e-09
  • amino acids 354 to 406 (53 residues), 28.9 bits, 9.5e-10
• PF14559: TPR_19
  • amino acids 116 to 175 (60 residues), 29.7 bits, 4.8e-10
• PF13431: TPR_17
  • amino acids 127 to 158 (32 residues), 22.2 bits, see alignment (E = 8.9e-08)
• PF00515: TPR_1
  • amino acids 138 to 171 (34 residues), 31.8 bits, see alignment (E = 6.5e-11)
  • amino acids 206 to 239 (34 residues), 29 bits, see alignment (E = 5.2e-10)
  • amino acids 310 to 340 (31 residues), 30.5 bits, see alignment (E = 1.7e-10)
• PF07719: TPR_2
  • amino acids 138 to 171 (34 residues), 27.3 bits, see alignment (E = 1.9e-09)
  • amino acids 206 to 238 (33 residues), 28.1 bits, see alignment (E = 1.1e-09)
  • amino acids 308 to 340 (33 residues), 27.9 bits, see alignment (E = 1.2e-09)
  • amino acids 342 to 374 (33 residues), 24.2 bits, see alignment (E = 1.9e-08)
• PF13181: TPR_8
  • amino acids 138 to 171 (34 residues), 22.5 bits, see alignment (E = 6.5e-08)
  • amino acids 172 to 197 (26 residues), 11.8 bits, see alignment (E = 0.00018)
  • amino acids 206 to 238 (33 residues), 26.4 bits, see alignment (E = 3.8e-09)
  • amino acids 274 to 306 (33 residues), 12.8 bits, see alignment (E = 8.7e-05)
  • amino acids 309 to 340 (32 residues), 24.8 bits, see alignment (E = 1.3e-08)
  • amino acids 342 to 374 (33 residues), 15.9 bits, see alignment (E = 8.9e-06)
  • amino acids 376 to 408 (33 residues), 16.3 bits, see alignment (E = 6.6e-06)
• PF13424: TPR_12
  • amino acids 138 to 202 (65 residues), 30.2 bits, E=3.1e-10
  • amino acids 273 to 339 (67 residues), 30.1 bits, E=3.3e-10
  • amino acids 308 to 370 (63 residues), 35.7 bits, E=6.1e-12
• PF13374: TPR_10
  • amino acids 142 to 168 (27 residues), 16.3 bits, see alignment (E = 6.1e-06)
  • amino acids 210 to 235 (26 residues), 19.4 bits, see alignment (E = 6.2e-07)
  • amino acids 279 to 305 (27 residues), 15.1 bits, see alignment (E = 1.5e-05)
  • amino acids 346 to 370 (25 residues), 15.3 bits, see alignment (E = 1.3e-05)
• PF13414: TPR_11
  • amino acids 148 to 183 (36 residues), 30.7 bits, see alignment (E = 1.5e-10)
  • amino acids 213 to 250 (38 residues), 27.7 bits, 1.3e-09
  • amino acids 289 to 321 (33 residues), 27.9 bits, see alignment (E = 1.1e-09)
  • amino acids 352 to 389 (38 residues), 33.8 bits, 1.6e-11
• PF01075: Glyco_transf_9
  • amino acids 642 to 674 (33 residues), 23.6 bits, see alignment (E = 2.3e-08)

Best Hits

KEGG orthology group: None (inferred from 87% identity to bug:BC1001_4073)

Predicted SEED Role

"FOG: TPR repeat"

Protein Sequence (732 amino acids)

>ABIE53_004037 tetratricopeptide (TPR) repeat protein (Paraburkholderia graminis OAS925)
MGDPARGRRTRNVTGLMTFTQTLASSIAQLNQQAIALYSADEFAAALSTVMPAIEHDEST
LDDAAIHAMADALNIAGASSCRLGHADDAERHWRRCLRIAPGYVEVYESFGALLKARGRL
SAAKAIYRQLIAMRPEHADAHNQLGAVLHAQGHHEEAEVSYRRALSLRPDHAEAHYNHGV
VLQTLRRLHEAEAAYRETLRRLPAHAQAHNNLGNVLMDLGRVDEADAAYRDALSIQPHYP
EALNNLAGALKAAQRLTEAELACRLALTMRPDYAEAHVNLGAALTDLARLPEAESAYRKA
IALCADYAGAHYNLGITLFKLERMEEAAAAYREAVRLRPDIAPAHNNLGCVLRLLDRLPE
AVDAFEQALSTDPDLAEAHYNLGAALAQLTRLPEAESAYRRALSLRADYGDARFGLATLL
LSMGRFEEGWPLYECRYQQTDFVHRQTAQRLSCPQWQGDALSGRSLLVWQEDGLGDMLQF
SRYFALLKAQGAAHIAFACAPALHRLMTRIDGVDSVLDHHTAAARASDYDCWTSLLSAPL
HLRTTIDTIPRPVRLAAEESLVEKWRPVLDALPPGRKIGLVWKGNAKHHNDANRSIPSLV
TLAPLWSVAGLSFVSLQKGQGEDEARNPPSDQPLLHVGSMVTDLADSAAIVAQLDLVICV
DTSIAHLAASLGKPCWVMLPEKDVDWRWMYERSDSPWYPHTLRLFRRERGEEWTSTVERV
RQACVARFGVRE