Protein Info for ABIE53_004021 in Paraburkholderia graminis OAS925

Annotation: putative membrane protein YagU involved in acid resistance

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 29 to 53 (25 residues), see Phobius details amino acids 83 to 108 (26 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 70% identity to ara:Arad_4056)

Predicted SEED Role

"FIG00461631: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>ABIE53_004021 putative membrane protein YagU involved in acid resistance (Paraburkholderia graminis OAS925)
MDGNLSASASEFKRTELSSRWTWPNRQAMIRAGVAGGLLGAVIIWIYEALIWVGAQHLMP
LAGIPRNATGLVFGKGVQESIGIWAYVVGTGIHFVFAIAWGVLFSAVWPYFRRRGIEATL
VALFYAVLAWIVMHVAIMIASDNHPNYYDPAVIIGGFMSHIFFTVPLALTVKRRFERKAQ
KSISTKT