Protein Info for ABIE53_003986 in Paraburkholderia graminis OAS925

Annotation: uronate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF04321: RmlD_sub_bind" amino acids 18 to 163 (146 residues), 32.4 bits, see alignment E=1.7e-11 PF01370: Epimerase" amino acids 20 to 178 (159 residues), 82.6 bits, see alignment E=9.2e-27 PF16363: GDP_Man_Dehyd" amino acids 20 to 184 (165 residues), 55.9 bits, see alignment E=1.5e-18 PF01073: 3Beta_HSD" amino acids 21 to 141 (121 residues), 49.2 bits, see alignment E=1.2e-16 PF13460: NAD_binding_10" amino acids 23 to 127 (105 residues), 33.8 bits, see alignment E=9.6e-12 PF07993: NAD_binding_4" amino acids 69 to 188 (120 residues), 31 bits, see alignment E=4.3e-11

Best Hits

Swiss-Prot: 56% identical to URODH_PSEPK: Uronate dehydrogenase (udh) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 84% identity to bph:Bphy_5673)

MetaCyc: 53% identical to uronic acid dehydrogenase subunit (Pseudomonas syringae)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.203 or 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>ABIE53_003986 uronate dehydrogenase (Paraburkholderia graminis OAS925)
MSQTISESSTVDRKPFRRLLLTGGAGNLGRQLRGALAEWAEVVRVTDIASLGDPAAHEET
SVVDLADRAAVMQLVAGVDAIVHLGGISIDAPFDDLLGANIAGTYNLYEAARKHGVKRIV
FASSNHVIGFHPVTEVIDADAPQRPDSLYGVTKCFGEALSRYYYDRFGIETVCMRIGSSF
EEPKNPRMLVTYLSYRDFIELVRCSLFTNRVGHVVVYGASDNPVKWWDNTKAAFLGFNPR
DSSAPFASRFPATAPDDSRDDPAQRFQGGPFVLGEPMEGEKPR