Protein Info for ABIE53_003980 in Paraburkholderia graminis OAS925

Annotation: nucleoside-diphosphate-sugar epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF05368: NmrA" amino acids 3 to 71 (69 residues), 27.9 bits, see alignment E=4.5e-10 PF01370: Epimerase" amino acids 3 to 217 (215 residues), 74.1 bits, see alignment E=3.5e-24 PF16363: GDP_Man_Dehyd" amino acids 4 to 72 (69 residues), 30.7 bits, see alignment E=6.9e-11 PF01073: 3Beta_HSD" amino acids 5 to 75 (71 residues), 22.3 bits, see alignment E=1.9e-08 PF13460: NAD_binding_10" amino acids 7 to 160 (154 residues), 46.9 bits, see alignment E=9.3e-16

Best Hits

Swiss-Prot: 45% identical to YGI2_SCHPO: Uncharacterized protein C2A9.02 (SPBC2A9.02) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 84% identity to bge:BC1002_6507)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>ABIE53_003980 nucleoside-diphosphate-sugar epimerase (Paraburkholderia graminis OAS925)
MRIFVTGATGFIGSALVPELIEAGHQVIGMTRSDAGAHALFAGGADVHRGTLEDVDSVRS
GVANADAVIHLAFDHDFSRFAANCEKDARVIEALGSALAGSDRPLLVTSGTGAGSRDDGQ
PATEDVFNTAHPNPRLATELASNVLLQAGVNVSVMRLPQVHNPFRQGLITPLIQIAREKR
VCAYVDEGRNRWPAGHLSDVVKLYRLAIERAERGARYHAVGEEGVSAREIAEALGRGLKL
PVVSIAREQTQAYFGWMAIFAALDMPASSALTQARLGWQPAGPTLIADLDEARYADDVPA