Protein Info for ABIE53_003969 in Paraburkholderia graminis OAS925

Annotation: MFS family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 50 to 70 (21 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 405 to 427 (23 residues), see Phobius details amino acids 434 to 455 (22 residues), see Phobius details PF07690: MFS_1" amino acids 83 to 331 (249 residues), 94.4 bits, see alignment E=6.9e-31 amino acids 310 to 460 (151 residues), 36.8 bits, see alignment E=2.2e-13 PF00083: Sugar_tr" amino acids 84 to 464 (381 residues), 115.1 bits, see alignment E=3.9e-37

Best Hits

KEGG orthology group: None (inferred from 55% identity to pdx:Psed_3759)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>ABIE53_003969 MFS family permease (Paraburkholderia graminis OAS925)
MQHPLEESSGGGTRGSLGGEPRVALDDATHAVWYRSINRQQWSALIASNLGWFFDGYETY
ALVLTVGGALGQLLPASGHAQIPFYAGLVIALTLLGWGIGGLIGGILTDYIGRKRMMMFA
ILAYSLTTGLSALSWDWTSFAALRFIVGLAMGSEWATGTAMTAEIWPDRHRGKGAGLMQC
GLGTGFFVASLIWLFMSGAGEHAWRYMYLIGVLPGLATLWMRAGIPESEQWQRVNTERKA
TLARRKSGVTLDAREQSLARFTLVDLLADAKLRRRTWIAVLMSLSTTLGWWGISTWVPPY
IGSVAAHAGLSAASWASFAGMAYNVGAISGYIGLGFLADAYGRKRITCLFFAMAFVLTPV
LFMWTHDVGLLLAVACVAGFFSLGQYTWMPTWLPELYPTRVRGTAIALCFNVPRFLAWTG
PLVAGTLITRFGGYGHAAVIVGFIYLVGLALAPWLPETRGQPLPEEV