Protein Info for ABIE53_003958 in Paraburkholderia graminis OAS925

Annotation: luciferase family oxidoreductase group 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03558: luciferase family oxidoreductase, group 1
  • amino acids 6 to 338 (333 residues), 342.6 bits, E=1.2e-106
• PF00296: Bac_luciferase
  • amino acids 18 to 312 (295 residues), 120.3 bits, E=5.9e-39

Best Hits

KEGG orthology group: None (inferred from 63% identity to bcm:Bcenmc03_6173)

Predicted SEED Role

"Bacterial luciferase family protein YtmO, in cluster with L-cystine ABC transporter"

Protein Sequence (354 amino acids)

>ABIE53_003958 luciferase family oxidoreductase group 1 (Paraburkholderia graminis OAS925)
MTTYALSLLDKSPIARGETPTEALRRTVELARHAESWGYRRYWLAEHHNTSQLACPSPEI
LIAYILARTNRIRVGSGGVMLQHYSPYKVAENFNLLASLAPGRVDLGIGKAPGGLPLSTR
ALQSARDPAHKPDFAALAFELDRYLADALAANREHDAADGDEQFGSVLRATPLPPSPARP
FLLGASVESAALAARLGWDFVYAAHINGAPDEIERALERYRAASNGRKALLALSVIAAES
ADEAARLASDTRRFRVQVGDQQPVTVGSIAQAEEFVRQAGGGAHRIDERENHIVHGTSDA
VHDALSELQDRYGVDEFIIDNPVTDAAQRIASVRLLARGLQHGNTREAAEAARG