Protein Info for ABIE53_003926 in Paraburkholderia graminis OAS925

Annotation: type VI secretion system protein ImpK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 179 to 198 (20 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 64 to 273 (210 residues), 223.8 bits, see alignment E=1.1e-70 PF09850: DotU" amino acids 65 to 266 (202 residues), 226.7 bits, see alignment E=2.3e-71 PF00691: OmpA" amino acids 337 to 436 (100 residues), 35.9 bits, see alignment E=8.2e-13

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 94% identity to bgf:BC1003_4188)

Predicted SEED Role

"Outer membrane protein ImpK/VasF, OmpA/MotB domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>ABIE53_003926 type VI secretion system protein ImpK (Paraburkholderia graminis OAS925)
MNTANRNDQPGGRFDATVIRPQPQAGADDATRIMPRHAPSRGHEQAASAAPRIELRELMS
GVVNPLVRAANPLLLLSVQLRHSVAAPADVARLREQAVAHVHSFERHAQDAGVNTQTVMA
ARYVLCTMLDEAVNNAPWGDLSGWAQKTLLVTFHGETYGGAKFFQILDRLSVDFSRHLDL
IEMMYICLALGFGGRYLVEPGGLGRLADIQDDLYRRIRGLREAPAAELAPHWRGVDDRRN
PVMRHVPLWIAAAASAVIVIGAFLYFFTRLNALAEPVGAQLAAIGTGSAPPPAGAAAPRP
ARPSLKALLAPLEQSGALAVDEQADGRDTIRLAAGALFPSGGADLLPDEIPLLRRVASAL
NQVRGRVIVVGHTDDQPVHSLRFKDNFALSTARAQNTLAVLAQGLDDPRRLEANGAGSSQ
PIATPADLPANRARNRRVEILFIPEN