Protein Info for ABIE53_003899 in Paraburkholderia graminis OAS925

Annotation: nucleoside-diphosphate-sugar epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 4 to 189 (186 residues), 27.4 bits, E=5.5e-10
• PF02719: Polysacc_synt_2
  • amino acids 5 to 125 (121 residues), 30.6 bits, E=6.1e-11
• PF01370: Epimerase
  • amino acids 5 to 203 (199 residues), 98.5 bits, E=1.2e-31
• PF01073: 3Beta_HSD
  • amino acids 6 to 166 (161 residues), 45.8 bits, E=1.2e-15
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 196 (191 residues), 73.5 bits, E=6.9e-24
• PF07993: NAD_binding_4
  • amino acids 77 to 189 (113 residues), 29.5 bits, E=1.3e-10

Best Hits

KEGG orthology group: None (inferred from 84% identity to bgd:bgla_2g25060)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Protein Sequence (299 amino acids)

>ABIE53_003899 nucleoside-diphosphate-sugar epimerase (Paraburkholderia graminis OAS925)
MTKRVIVTGGSGLAGKWVVEDLVAHGYEVLNVDRVPMAKGTARTLITDITDAGQVFNAFA
STTTAKEFDDDIEPKPIDAVVHFAAIPRILVTTDNEVFRINVMGTYNVLDAAAKLGIRKV
IVASSETTYGVVFAHRHRDPAYFPLDEEYPVDPMDSYATSKVINEVTAKAFHARTGSDIY
CFRIGNVLDPEDYRKFPVWLKDPALRKRIAWSYIDGRDLAAACRLGIEKDGLGYTVMNVA
ADDVSSDRPVAELLKTYYPNVPVKKPLGEFETLLSNEKLKRLLGWQQAYRWREQVSSQS