Protein Info for ABIE53_003888 in Paraburkholderia graminis OAS925
Annotation: L-fuculose-phosphate aldolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01628, L-fuculose-phosphate aldolase [EC: 4.1.2.17] (inferred from 59% identity to pde:Pden_4596)MetaCyc: 37% identical to 5-deoxy-D-ribulose 1-phosphate aldolase (Bacillus thuringiensis)
RXN-21316 [EC: 4.1.2.62]
Predicted SEED Role
"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"
MetaCyc Pathways
- 5'-deoxyadenosine degradation II (4/4 steps found)
- 5'-deoxyadenosine degradation I (2/3 steps found)
- lactate biosynthesis (archaea) (3/5 steps found)
- D-arabinose degradation II (2/4 steps found)
- L-fucose degradation I (2/4 steps found)
- S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)
- nucleoside and nucleotide degradation (halobacteria) (1/6 steps found)
- superpathway of fucose and rhamnose degradation (5/12 steps found)
- superpathway of pentose and pentitol degradation (21/42 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.2.17 or 4.1.2.62
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (223 amino acids)
>ABIE53_003888 L-fuculose-phosphate aldolase (Paraburkholderia graminis OAS925) MSAATERALRRDIVETSLEMERLGINQGTSGNVSARLGDGFLITPSGVPARELREDSIVW LSLDVADDADVLREKRPSSEWRIHRDILRARQEMHAVVHTHSIAATAMAIHGRDIPALHY MVAAAGGDSIRCAPYALFGTQLLSDHALTALQNRRACLLAHHGVVALGVDLARAVWLAHE VEVLARQYLLACQLGAPPLLSGEQMDEVLEKFKTYGRRKEAER