Protein Info for ABIE53_003791 in Paraburkholderia graminis OAS925

Annotation: small subunit ribosomal protein S12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00981: ribosomal protein uS12
  • amino acids 1 to 124 (124 residues), 233 bits, E=2.9e-74
• PF00164: Ribosom_S12_S23
  • amino acids 13 to 123 (111 residues), 145.3 bits, E=2.8e-47

Best Hits

Swiss-Prot: 100% identical to RS12_PARP8: 30S ribosomal protein S12 (rpsL) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K02950, small subunit ribosomal protein S12 (inferred from 98% identity to bgd:bgla_1g02970)

MetaCyc: 82% identical to 30S ribosomal subunit protein S12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S12p (S23e)" in subsystem Ribosomal protein S12p Asp methylthiotransferase or Ribosome SSU bacterial

Protein Sequence (126 amino acids)

>ABIE53_003791 small subunit ribosomal protein S12 (Paraburkholderia graminis OAS925)
MPTINQLVRKGRTSETTKSKSPALQDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNG
FEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGAK
RAKAGK