Protein Info for ABIE53_003750 in Paraburkholderia graminis OAS925

Annotation: sulfoxide reductase heme-binding subunit YedZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details PF01794: Ferric_reduct" amino acids 79 to 192 (114 residues), 63.4 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 59% identical to MSRQ_BORPE: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: None (inferred from 88% identity to bug:BC1001_3245)

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>ABIE53_003750 sulfoxide reductase heme-binding subunit YedZ (Paraburkholderia graminis OAS925)
MASDTQSVARTERNAPRAQARATQTAGATAKRPSAGARWVVPAKIAVFIAAWYPLARIVL
FGMTDRLGANPIEFITRSTGLWTLVFLCITLAVTPLRRLTGVAAFVRFRRMLGLYAFFYA
TLHFTTYLWFDKWFDVAEIIKDIGKRPFITVGFAAFVLLIALAATSPRAMVRKLGRRWQT
LHRAIYVIGALAILHFWWMKAGKHDLILPKIYGAIMLALLGWRLIVWLRARSLKPR