Protein Info for ABIE53_003740 in Paraburkholderia graminis OAS925

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR01357: 3-dehydroquinate synthase" amino acids 16 to 354 (339 residues), 397.3 bits, see alignment E=3e-123 PF13685: Fe-ADH_2" amino acids 20 to 225 (206 residues), 46.9 bits, see alignment E=3.2e-16 PF01761: DHQ_synthase" amino acids 70 to 327 (258 residues), 362.3 bits, see alignment E=1.2e-112

Best Hits

Swiss-Prot: 89% identical to AROB_BURCM: 3-dehydroquinate synthase (aroB) from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 98% identity to bgf:BC1003_3195)

MetaCyc: 55% identical to 3-dehydroquinate synthase (Escherichia coli K-12 substr. MG1655)
3-dehydroquinate synthase. [EC: 4.2.3.4]

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>ABIE53_003740 3-dehydroquinate synthase (Paraburkholderia graminis OAS925)
MGRMITVNVELGERAYPIHIGADLIGQTALFAPHIAGNSVTIVTNTTVDPLYGDTLRAAL
APLGKQVSTVVLPDGEAYKNLETLNLIFDALLGSRADRKTTLIALGGGVIGDMTGFAAAC
YMRGVPFIQVPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPRAVIADIGALRTLPARE
LAAGIAEVIKTGAIADAGFFRWIEANVEALNRCEPAALAEAVKRSCEIKASVVAQDEREG
GLRAILNFGHTFGHAIEAGLGYGEWLHGEAVGCGMVMAADLSVRLGYLDEASRKRLVDVI
VAAHLPTRAPALGESRYIELMQVDKKAEAGAIKFILLKRFGETLITQAPDAEVHATLAAA
V