Protein Info for ABIE53_003726 in Paraburkholderia graminis OAS925

Annotation: two-component system phosphate regulon response regulator OmpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 5 to 114 (110 residues), 106.1 bits, E=1.1e-34
• PF00486: Trans_reg_C
  • amino acids 154 to 229 (76 residues), 63.7 bits, E=1.4e-21

Best Hits

Swiss-Prot: 43% identical to PETR_RHOCB: Protein PetR (petR) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: None (inferred from 99% identity to bug:BC1001_3224)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Protein Sequence (246 amino acids)

>ABIE53_003726 two-component system phosphate regulon response regulator OmpR (Paraburkholderia graminis OAS925)
MNPQVLIVDDDPVVRDLLCKFLQSNGFDASVLHDGTHLQRRLERERPSVVVLDIMMPNTD
GLRALTALRAAGDDIPVIFVTARGTVADRIVGLSLGADDYLTKPFDPRELLARIHTVLRR
RGPSTTSAPEARKPYRFGPFELDFATRSLSRADTKLPLRDSEFALLKIFVNNPYKVLSRV
LIHDLVHRDNLAFRDRSLDVPIWRLRRVIEDDPSNPCYVQTVRGKGYVFVPDADGTPFSD
EAASNA