Protein Info for ABIE53_003714 in Paraburkholderia graminis OAS925

Annotation: thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05690: ThiG
  • amino acids 15 to 260 (246 residues), 337.1 bits, E=3e-105

Best Hits

Swiss-Prot: 88% identical to THIG_BURL3: Thiazole synthase (thiG) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 99% identity to bpy:Bphyt_3573)

MetaCyc: 44% identical to thiazole synthase (Bacillus subtilis subtilis 168)
THIAZOLSYN2-RXN [EC: 2.8.1.10]

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (4/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.10

Protein Sequence (274 amino acids)

>ABIE53_003714 thiazole synthase (Paraburkholderia graminis OAS925)
MMQMTSPQTADALTLYGQPFASRVLLGTSRYPSLQSLSDSIDAARPGMVTVALRRQMNEG
GAEAGFFDLLKRHGVPLLPNTAGCLTVGEAVATAHMAREIFETEWIKLELIGDDYTLQPD
PVGLIEAAAKLVKDGFKVLPYCTEDLVIGRRLLDAGCEALMPWGAPIGTGKGVINPYGLR
VLRERLPDVPLIVDAGLGVPSHAAQVMEWGFDGVLLNTAVSQATHPDAMARAFALGVEAG
RQAFLAGPMAERESAHASTPVVGMPFWHQDGSAA