Protein Info for ABIE53_003702 in Paraburkholderia graminis OAS925

Annotation: ATP phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00070: ATP phosphoribosyltransferase
  • amino acids 17 to 202 (186 residues), 199.5 bits, E=2.3e-63
• PF01634: HisG
  • amino acids 66 to 221 (156 residues), 183 bits, E=1.9e-58

Best Hits

Swiss-Prot: 91% identical to HIS1_BURCH: ATP phosphoribosyltransferase (hisG) from Burkholderia cenocepacia (strain HI2424)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 97% identity to bxe:Bxe_A0397)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.17

Use Curated BLAST to search for 2.4.2.17

Protein Sequence (232 amino acids)

>ABIE53_003702 ATP phosphoribosyltransferase (Paraburkholderia graminis OAS925)
MSSMPQTSSSPAVSAPLTLALSKGRIFEETLPLLAAAGIEVAEDPESSRKLILPTTDANL
RVIIVRATDVPTYVEYGAADFGVAGKDVLLEHGGSGLYQPVDLDIARCRMSVAVAAGFDY
ANAVRQGARLRVATKYVETAREHFAAKGVHVDLIKLYGSMELAPLVGLADAIVDLVSSGN
TLRANHLVEVEEVMQISSRLVVNQAALKLKRAALRPILDAFERATKAGVAAA