Protein Info for ABIE53_003691 in Paraburkholderia graminis OAS925

Annotation: histidine triad (HIT) family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 6 to 112 (107 residues), 87.3 bits, E=1e-28
• PF01230: HIT
  • amino acids 15 to 113 (99 residues), 91.2 bits, E=5.8e-30

Best Hits

Swiss-Prot: 48% identical to HITA_NEIGO: Protein HitA (hitA) from Neisseria gonorrhoeae

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 95% identity to bpy:Bphyt_3550)

MetaCyc: 46% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"FIG146285: Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases"

Protein Sequence (121 amino acids)

>ABIE53_003691 histidine triad (HIT) family protein (Paraburkholderia graminis OAS925)
MSHDPNCLFCKIAAGEIPSTKVHEDEEFLAFRDIRPAAETHVLVIPRKHIATLTDCTESD
APMLGRMLVLTARLADQLGVAYTGGETGFRTVINTGPGGGQEVYHLHAHILAGPRPWQRM
G