Protein Info for ABIE53_003680 in Paraburkholderia graminis OAS925

Annotation: methylase of polypeptide subunit release factors

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF05175: MTS" amino acids 173 to 311 (139 residues), 50.2 bits, see alignment E=8.3e-17 PF13489: Methyltransf_23" amino acids 182 to 342 (161 residues), 28 bits, see alignment E=5.9e-10 PF06325: PrmA" amino acids 198 to 266 (69 residues), 45.3 bits, see alignment E=3e-15 PF13649: Methyltransf_25" amino acids 201 to 254 (54 residues), 33.3 bits, see alignment 2.3e-11 PF08241: Methyltransf_11" amino acids 201 to 254 (54 residues), 27.9 bits, see alignment 1e-09 PF01170: UPF0020" amino acids 218 to 269 (52 residues), 26.1 bits, see alignment 2.2e-09

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_3178)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>ABIE53_003680 methylase of polypeptide subunit release factors (Paraburkholderia graminis OAS925)
MNSPASITWPEADGPRTARWRSEAAVPPPKRVIVADDRTTADSAYRLACEGTALLWNGDF
QNARQLLQAFTRRLERKPRKQGETPLDAFNLHRQTQSQRARTLGMILIPLNAEYAIPLRR
APDVRQACIETYGPPTDEASVVSLRELLGMIGAHEWRKKGVEIPALGDRIHPHYGVFSPV
RGEYVDLVARTPLPSLNKAFDVGTGTGVLAALLAKRGVKKIVATDQDPRALACARENLAR
LGYEQQVDVVQADLFPEGRAPLIVCNPPWVPARPASPIEYAVYDPDSRMLLGFLKGLSEH
LSPGGEGWLILSDFAEHLGLRTREWLLAAIADAGLTVVAREDIRPRHPKSTDESDPLHKA
RMVEMTSLWRLKARG