Protein Info for ABIE53_003645 in Paraburkholderia graminis OAS925

Annotation: uracil-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR00628: uracil-DNA glycosylase" amino acids 59 to 268 (210 residues), 252.8 bits, see alignment E=1.5e-79 PF03167: UDG" amino acids 104 to 264 (161 residues), 77.6 bits, see alignment E=5.2e-26

Best Hits

Swiss-Prot: 63% identical to UNG_RALPJ: Uracil-DNA glycosylase (ung) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03648, uracil-DNA glycosylase [EC: 3.2.2.-] (inferred from 89% identity to bug:BC1001_3140)

Predicted SEED Role

"Uracil-DNA glycosylase, family 1" in subsystem DNA Repair Base Excision

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>ABIE53_003645 uracil-DNA glycosylase (Paraburkholderia graminis OAS925)
MTSSSRTRSTPSQASLFGDAAAPASDTSGATETPSPSSSQQHAHGTLTLEAQFAALPAAW
RAHLKPFIESDAYAPLCRFVDGERAAGKTVYPTDVFRALRLTSPDDVKVVILGQDPYHGE
DRGTPQAHGLAFSVAPNVRTPPSLRNIFKEIATSLGHEPPRHGCLDTWAKQGVLLLNTVL
TVERNSAASHAKRGWEKCTDTLIHELAMRHEHLVFMLWGAHAQAKRALFGGKSHYVLEAP
HPSPLSAHRGFLGCGHFAKANEYLVQHGRTPIDWRLPDQAQMLA