Protein Info for ABIE53_003595 in Paraburkholderia graminis OAS925

Annotation: type IV pilus assembly protein PilC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 175 to 197 (23 residues), see Phobius details amino acids 218 to 247 (30 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details PF00482: T2SSF" amino acids 73 to 198 (126 residues), 95.3 bits, see alignment E=1.4e-31 amino acids 279 to 401 (123 residues), 85.1 bits, see alignment E=2e-28

Best Hits

Swiss-Prot: 38% identical to PILC_VIBCH: Type IV pilin assembly protein PilC (pilC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02653, type IV pilus assembly protein PilC (inferred from 90% identity to bgf:BC1003_3039)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>ABIE53_003595 type IV pilus assembly protein PilC (Paraburkholderia graminis OAS925)
MSTPITRRPASTDTRFRWRGVDVDGSRKTGVLIAPDAATARTLLKRENVFLADLKTEGPA
PRPKANAAEVTLFTRQLSSLLRAGLPLAPALDLLAQPQNSRRAGMPRIVGALARDITAGL
RFSAALHGHPAQFNALYCQLVQVGEAAGALPAVLARIADDRERAAAQRAKVRAALTYPVA
ILLLAVAITAALLVWVVPTFKQIFDGFGARLPAPTQFVLALSSGVATWSVPAIAVIVAAC
SAVTFLLRRSEAARIRFARLSLKMPIAGALLATLCAARWSRALGTLLSAGTPLADAFDSL
THATGNAFFDRATVDIAVRLRRGERLAAAMRAARCFPPEVVQPIAVAEESGAIDTMLLDV
ASLADRQVDEKIGTLSSLCEPLVIIVLGALVGGLVIAMYLPIIQLGNVV