Protein Info for ABIE53_003505 in Paraburkholderia graminis OAS925

Annotation: dihydroorotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR00856: dihydroorotase, homodimeric type" amino acids 14 to 355 (342 residues), 472.3 bits, see alignment E=3.9e-146 PF01979: Amidohydro_1" amino acids 21 to 323 (303 residues), 76.1 bits, see alignment E=3.2e-25

Best Hits

Swiss-Prot: 77% identical to PYRC_RALSO: Dihydroorotase (pyrC) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 94% identity to bug:BC1001_3001)

MetaCyc: 53% identical to dihydroorotase (Escherichia coli K-12 substr. MG1655)
Dihydroorotase. [EC: 3.5.2.3]

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>ABIE53_003505 dihydroorotase (Paraburkholderia graminis OAS925)
MTAPNAASASLDSVTLTRPDDWHLHVRDGAMLAAVLPDTARQFGRAIIMPNLKPPVTTTA
MAQAYRERIVAAIPAGAQFEPLMTLYLTDNTPPDEIRRARESGFVHGVKLYPAGATTNSD
AGVTDIMKCAKTLEVMQETGMPLLVHGEVTDSSIDLFDREKVFIDRVMTPLRREFPALKV
VFEHITTKDAVDYIREAGVAPELLGATITAHHLLYNRNAIFQGGIRPHYYCLPVLKRETH
RLALVEAATSGNPRFFLGTDSAPHPKGLKEHACGCAGCYTALHALELYTEAFDKAGALDK
LEGFASFYGADFYGLPRNAGKVTLRREEWTLPAELPVGDTPVVPLRGGESIGWRLI