Protein Info for ABIE53_003450 in Paraburkholderia graminis OAS925

Annotation: two-component system sensor histidine kinase TctE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 51 to 71 (21 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details PF08521: 2CSK_N" amino acids 56 to 201 (146 residues), 154.4 bits, see alignment E=3.1e-49 PF00512: HisKA" amino acids 279 to 342 (64 residues), 51.8 bits, see alignment E=1.1e-17 PF02518: HATPase_c" amino acids 390 to 503 (114 residues), 91 bits, see alignment E=1.1e-29

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 97% identity to bug:BC1001_2945)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>ABIE53_003450 two-component system sensor histidine kinase TctE (Paraburkholderia graminis OAS925)
MSARADRATARPADLDEARDERYANPFAPPDETEAAAEARPRSLFGEILDWMLAPLLLLW
PMSLAVTYLVAKSIANGPFDRALETDAYVLARQIHPVNGVAELTLPDSTRDFLRTDNVDS
VFYQVLGTRGELVAGERDMPLPHEDDRPQPGLVAFRDDMLRGNDIRVAYTTVEFPQTPGA
EPVLVQVAETLDKRSQLANDIIKGVILPQFVILPLAILLVWFGLSRGLAPLHALQAHIRA
RRPDDLSPLEARRAPPEIEPLVTSFNDLLTRLEQNMELQKRFIADAAHQMKTPLAGLRTQ
AELALRQDASAEVHRSLEQIATSSEHAARLVTQLLALARAENRMSGQIFTPVEVTEVARN
AVRDWVQAALAKQMDLGYEAPEEPIEVDGNPVMLREMLSNLIDNAIRYTPEGGRITVRVR
RDAAARLVHLEVEDTGIGIPAAERSRVVERFYRILGREGDGSGLGLAIVREIATMHGGEL
TIDDNVYQTAPRLAGTLVRVSLHVLERGRTYPNAG