Protein Info for ABIE53_003443 in Paraburkholderia graminis OAS925

Annotation: YjbE family integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 12 to 191 (180 residues), 235.3 bits, see alignment E=1.8e-74 PF03741: TerC" amino acids 15 to 190 (176 residues), 171.8 bits, see alignment E=6.3e-55

Best Hits

KEGG orthology group: None (inferred from 97% identity to bgf:BC1003_2876)

Predicted SEED Role

"Membrane protein TerC, possibly involved in tellurium resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>ABIE53_003443 YjbE family integral membrane protein (Paraburkholderia graminis OAS925)
MLEFLATLHWGAVIQIIVIDILLGGDNAVVIALACRNLPPAQRTKGVLWGTAGAILLRVV
LIAFAVALLDVPLLKFAGGLLLLWIGVRLMAPAHDAHENVKPADKLISAIKTIIVADAVM
SLDNVIAIAGAAEAADPEHRLALVIFGLVVSIPLIVWGSQIVLKLLDRFPIVITLGAALL
GWIAGGLIINDPAGDRWPVLDTPLAEYGMSIAGALFVVILGYVIKRRNAKSAAA