Protein Info for ABIE53_003422 in Paraburkholderia graminis OAS925

Annotation: L-threonylcarbamoyladenylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family" amino acids 27 to 228 (202 residues), 167.6 bits, see alignment E=9.9e-54 PF01300: Sua5_yciO_yrdC" amino acids 37 to 217 (181 residues), 183 bits, see alignment E=3.8e-58 PF03481: Sua5_C" amino acids 219 to 352 (134 residues), 83.7 bits, see alignment E=1.9e-27

Best Hits

KEGG orthology group: K07566, putative translation factor (inferred from 94% identity to bug:BC1001_2919)

Predicted SEED Role

"TsaC protein (YrdC-Sua5 domains) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>ABIE53_003422 L-threonylcarbamoyladenylate synthase (Paraburkholderia graminis OAS925)
MPDPQTPGQAGHSDQSGEGAANALPVSAAQIEHAAALLDAGGLVAFPTETVYGLGGDAEN
PDAVARIYAAKGRPANHPVIVHLAPQGDPNYWVEHLPQEAQRLIDAFWPGPLTLILKRAA
RIPAAVSGGQDSVGLRCPSHPVAQALLEAFSSLRAGHGGVAAPSANRFGHVSPTTAQHVR
DEFGSAIHVLDGGASDVGIESTIVDLSRGFPALLRPGRVTPQDIADVLGEAPRLPDGSDA
TAPRASGTLKAHYAPRTPLALLPFNALEPLLAARAAGERVALVARASRAGHWADAEGVHF
IAAPEDPHVYARELYGLLRALDRANVARILIEKLPDTIEWIAVNDRLGRAAAAFEAQGH