Protein Info for ABIE53_003381 in Paraburkholderia graminis OAS925

Annotation: tryptophan 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF03301: Trp_dioxygenase" amino acids 47 to 314 (268 residues), 222.5 bits, see alignment E=5.3e-70 TIGR03036: tryptophan 2,3-dioxygenase" amino acids 51 to 313 (263 residues), 440 bits, see alignment E=1.5e-136

Best Hits

Swiss-Prot: 93% identical to T23O_PARPJ: Tryptophan 2,3-dioxygenase (kynA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00453, tryptophan 2,3-dioxygenase [EC: 1.13.11.11] (inferred from 92% identity to bxe:Bxe_A0733)

Predicted SEED Role

"Tryptophan 2,3-dioxygenase (EC 1.13.11.11)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 1.13.11.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>ABIE53_003381 tryptophan 2,3-dioxygenase (Paraburkholderia graminis OAS925)
MNDHMQTPGLPEEKPAQGCPFGHGSAASADAATAATNASSAEDGWHDAQLDFSGSMSYGD
YLSLGTVLNAQHPLSPDHNEMLFIIQHQTSELWMKLALYELRAALDAVHRDELPPAFKML
ARVSRIMEQLVQAWSVLATMTPSEYTAMRPYLGSSSGFQSYQYRQIEFLLGNKNEQMLKP
HAHRADVLAEVKASLEAPSFYDEVVKLLARRGFAISPSRLARDWTQPTVHDASVEAAWLE
VYRNPSQHWELYEMAEELVDLEDAFRQWRFRHVTTVERIIGFKQGTGGTSGAPYLRKMLD
VVLFPELWHVRTVL