Protein Info for ABIE53_003379 in Paraburkholderia graminis OAS925

Annotation: arylformamidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03035: arylformamidase
  • amino acids 4 to 208 (205 residues), 326.9 bits, E=3.1e-102
• PF04199: Cyclase
  • amino acids 6 to 151 (146 residues), 68 bits, E=5.4e-23

Best Hits

Swiss-Prot: 93% identical to KYNB_PARPJ: Kynurenine formamidase (kynB) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K07130, (no description) (inferred from 92% identity to bxe:Bxe_A0735)

Predicted SEED Role

"Kynurenine formamidase, bacterial (EC 3.5.1.9)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 3.5.1.9)

MetaCyc Pathways

• L-tryptophan degradation I (via anthranilate) (3/3 steps found)
• NAD de novo biosynthesis II (from tryptophan) (7/9 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis II (3/5 steps found)
• L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (3/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (8/14 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis I (2/6 steps found)
• quinoxaline-2-carboxylate biosynthesis (4/10 steps found)
• 3-hydroxyquinaldate biosynthesis (2/8 steps found)
• L-tryptophan degradation IX (4/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (4/12 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (19/35 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (7/23 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.9

Use Curated BLAST to search for 3.5.1.9

Protein Sequence (212 amino acids)

>ABIE53_003379 arylformamidase (Paraburkholderia graminis OAS925)
MQTLWDITPAVDTATPVWPGDTPVGIERVWRMEAGSPVNVARLTLSPHTGAHTDAPLHYD
AEGAAIGQVPLDAYLGRCRVIHCIGASPVVTPQHLRDSLGGLPPRVLLRTYRNAPTAAWD
SGFCAVAPETIDLLAANGVKLIGIDTPSLDPQESKTMDAHHRIRAHGMAILEGIVLDDVA
PGDYELIALPLKLTTLDASPVRAVLRALPDAH