Protein Info for ABIE53_003373 in Paraburkholderia graminis OAS925

Annotation: pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00558: pyridoxamine 5'-phosphate oxidase
  • amino acids 3 to 213 (211 residues), 291.7 bits, E=1.6e-91
• PF12766: Pyridox_oxase_2
  • amino acids 30 to 112 (83 residues), 36.9 bits, E=7e-13
• PF01243: Putative_PNPOx
  • amino acids 34 to 118 (85 residues), 96.6 bits, E=1.2e-31
• PF10590: PNP_phzG_C
  • amino acids 171 to 213 (43 residues), 78.5 bits, 4.1e-26

Best Hits

Swiss-Prot: 92% identical to PDXH_PARPJ: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 98% identity to bgf:BC1003_2807)

MetaCyc: 48% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• pyridoxal 5'-phosphate salvage II (plants) (8/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (10/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• pyridoxal 5'-phosphate salvage I (5/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Protein Sequence (213 amino acids)

>ABIE53_003373 pyridoxamine 5'-phosphate oxidase (Paraburkholderia graminis OAS925)
MTSLAELRKNYSLGSLDIGDVDRDPFRQFDVWFQQAVEAKLPEPNTMTLATVDSRGRPSA
RIVLIKGVDERGFVFFTNYESRKGRELAANPYASLLFYWIELERQVRIEGRVVKTSAAES
DAYFASRPPGSRIGAWASNQSQVIESRSQLETREREMRLQYGDEPPRPPHWGGYRLVPEA
IEFWQGRPSRLHDRLLYTRSSENSDWQICRLSP