Protein Info for ABIE53_003363 in Paraburkholderia graminis OAS925

Annotation: epoxyqueuosine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF08331: QueG_DUF1730" amino acids 80 to 179 (100 residues), 63.7 bits, see alignment E=1.2e-21 TIGR00276: epoxyqueuosine reductase" amino acids 129 to 405 (277 residues), 367.1 bits, see alignment E=4e-114 PF13484: Fer4_16" amino acids 240 to 304 (65 residues), 85.5 bits, see alignment E=3.7e-28

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_2863)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>ABIE53_003363 epoxyqueuosine reductase (Paraburkholderia graminis OAS925)
MCPVSNAPATGDEARAERQFDEAALHALAQNIKTWGRELGFGAIGISDTDLSAAEAPLAA
WLEAGCHGEMDYMAKHGMKRARPAELVAGTLRVITARIAYLPADVLNGKQPESDSSKGPL
NQDWRGAEHARLADPAAAVVSIYARGRDYHKVMRNRLQHLSEKIQAEIGAFGYRVFTDSA
PVLEVELAQKAGIGWRGKHTLLLQRDAGSLFFLGEIYVDVPLPTDAETSPEVAPETPGSH
CGSCSRCIDACPTGAIVGPYKVDARLCISYLTIELKGSIPVEMRPLIGNRVYGCDDCQLV
CPWNKFAQAAPVADFDVRHGLDRASLVELFGWSADDFDTRMQGSAIRRIGYESWLRNLAV
GMGNALRASRDALSAEAREAIVEALRRRADDPSALVREHVQWALEAA