Protein Info for ABIE53_003354 in Paraburkholderia graminis OAS925

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00658: ornithine carbamoyltransferase
  • amino acids 7 to 303 (297 residues), 355.8 bits, E=9.2e-111
• PF02729: OTCace_N
  • amino acids 7 to 145 (139 residues), 165.3 bits, E=1e-52
• PF00185: OTCace
  • amino acids 154 to 301 (148 residues), 181.3 bits, E=1.4e-57

Best Hits

Swiss-Prot: 91% identical to OTC_BURMA: Ornithine carbamoyltransferase (argF) from Burkholderia mallei (strain ATCC 23344)

KEGG orthology group: None (inferred from 98% identity to bug:BC1001_2854)

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-citrulline degradation (3/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• urea cycle (3/5 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Protein Sequence (309 amino acids)

>ABIE53_003354 ornithine carbamoyltransferase (Paraburkholderia graminis OAS925)
MTAKKIRHYLQFKDFSLDDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTR
LSFEAGIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIQRFAEN
SRVPVINGLTNEYHPCQVLADIFTYFEHRGPIRGKTVAWVGDANNMLYTWIEAAQILGFK
LRLSTPPGYKLDRGFVAAESAPFYEEFDDPNEACAGADLVTTDVWTSMGFEAENEARKKA
FADWCVDAEMMSRAHADALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALME
YLLLGKLNH