Protein Info for ABIE53_003175 in Paraburkholderia graminis OAS925

Annotation: tetratricopeptide (TPR) repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13432: TPR_16
  • amino acids 11 to 69 (59 residues), 30.2 bits, 5.2e-10
  • amino acids 73 to 137 (65 residues), 49.6 bits, E=4.4e-16
  • amino acids 120 to 170 (51 residues), 37.5 bits, 2.8e-12
  • amino acids 177 to 239 (63 residues), 41.2 bits, E=1.9e-13
  • amino acids 243 to 305 (63 residues), 34.4 bits, E=2.5e-11
  • amino acids 279 to 329 (51 residues), 23.9 bits, 4.8e-08
• PF13181: TPR_8
  • amino acids 36 to 68 (33 residues), 15.7 bits, see alignment (E = 1.4e-05)
  • amino acids 71 to 101 (31 residues), 20.9 bits, see alignment (E = 3e-07)
  • amino acids 105 to 136 (32 residues), 19.1 bits, see alignment (E = 1.2e-06)
  • amino acids 137 to 169 (33 residues), 24.8 bits, see alignment (E = 1.7e-08)
  • amino acids 172 to 202 (31 residues), 17.7 bits, see alignment (E = 3.3e-06)
  • amino acids 207 to 237 (31 residues), 20.4 bits, see alignment (E = 4.3e-07)
  • amino acids 241 to 271 (31 residues), 20.9 bits, see alignment (E = 3e-07)
  • amino acids 275 to 305 (31 residues), 13.2 bits, see alignment (E = 9.1e-05)
• PF13176: TPR_7
  • amino acids 37 to 68 (32 residues), 14 bits, see alignment (E = 4.7e-05)
  • amino acids 105 to 136 (32 residues), 19.1 bits, see alignment (E = 1.1e-06)
  • amino acids 140 to 168 (29 residues), 20.1 bits, see alignment (E = 5.4e-07)
  • amino acids 207 to 237 (31 residues), 16.9 bits, see alignment (E = 5.4e-06)
• PF07721: TPR_4
  • amino acids 37 to 60 (24 residues), 12.4 bits, see alignment (E = 0.00022)
  • amino acids 103 to 128 (26 residues), 20.7 bits, see alignment (E = 4.7e-07)
  • amino acids 139 to 162 (24 residues), 15.8 bits, see alignment (E = 1.9e-05)
  • amino acids 206 to 229 (24 residues), 11.3 bits, see alignment (E = 0.00052)
  • amino acids 307 to 327 (21 residues), 11.1 bits, see alignment (E = 0.00059)
• PF14559: TPR_19
  • amino acids 47 to 89 (43 residues), 29.2 bits, 9.9e-10
  • amino acids 81 to 138 (58 residues), 31.8 bits, 1.5e-10
  • amino acids 183 to 237 (55 residues), 28.6 bits, 1.5e-09
  • amino acids 218 to 276 (59 residues), 29.3 bits, 9.3e-10
• PF07719: TPR_2
  • amino acids 70 to 101 (32 residues), 24.1 bits, see alignment (E = 2.7e-08)
  • amino acids 104 to 136 (33 residues), 30.8 bits, see alignment (E = 1.9e-10)
  • amino acids 138 to 170 (33 residues), 27.9 bits, see alignment (E = 1.7e-09)
  • amino acids 206 to 237 (32 residues), 24.3 bits, see alignment (E = 2.5e-08)
• PF13374: TPR_10
  • amino acids 70 to 98 (29 residues), 15.2 bits, see alignment (E = 1.9e-05)
  • amino acids 138 to 167 (30 residues), 21.3 bits, see alignment (E = 2.2e-07)
  • amino acids 171 to 199 (29 residues), 15.5 bits, see alignment (E = 1.5e-05)
• PF13428: TPR_14
  • amino acids 70 to 111 (42 residues), 24.2 bits, 3.8e-08
• PF00515: TPR_1
  • amino acids 72 to 102 (31 residues), 28.4 bits, see alignment (E = 1.1e-09)
  • amino acids 105 to 136 (32 residues), 32.7 bits, see alignment (E = 4.8e-11)
  • amino acids 137 to 169 (33 residues), 33.5 bits, see alignment (E = 2.6e-11)
• PF13414: TPR_11
  • amino acids 76 to 117 (42 residues), 45.5 bits, 5e-15
  • amino acids 110 to 151 (42 residues), 36.5 bits, 3.3e-12
• PF13174: TPR_6
  • amino acids 105 to 135 (31 residues), 13.3 bits, see alignment (E = 0.00012)
• PF13424: TPR_12
  • amino acids 105 to 167 (63 residues), 38.7 bits, E=9.8e-13
  • amino acids 137 to 199 (63 residues), 41.2 bits, E=1.7e-13
  • amino acids 171 to 235 (65 residues), 32.8 bits, E=7e-11
• PF13431: TPR_17
  • amino acids 125 to 158 (34 residues), 26.1 bits, see alignment (E = 7.4e-09)

Best Hits

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_2657)

Predicted SEED Role

"TPR repeat"

Protein Sequence (615 amino acids)

>ABIE53_003175 tetratricopeptide (TPR) repeat protein (Paraburkholderia graminis OAS925)
MQPVFDRAFAAHRDGRLDDAERGYRATLDGNPAHVDALHLLGVLRHQQGQHAEAAELVRR
AVNLRPQDAALQLNLGNALKALGQIDEAIDQFRNALTLAPSFPMAHYNLGNAYAATGRHE
DAADAFRRSLHLQPDDASSHNNLGNALHALGRHEEAIASFRRTLELRPGHAGALNNMGMS
LNALGRADEAIPCFKAALAAEPRFVAAHFNLANTFDATGRHAQAVASFEAALALQPNLPP
AIYGMGNALAALGRHTEAIPYLERSVGLDPQFALAWLSLGTAHQALGAHATALRAFDQAL
RLQPDLASAHMNRALAWLALGDFARGLPEYEWRLQTVAEPAIETLPRWHGEPAAQRTLLI
HAEQGFGDTLQFVRFVSLAAQRAARVVLEVQPPLLPLLAPVAEAWRVTLIARGAPRPAAD
VQCPLLSLPLALGTTFATIPERTPYLSAPPAYRRKWRGSIGGQAKRKIGLAWSGRIQQNE
TRSMPLAALEPLFALEGIDWIVLQPHLSAEERAALDGHPRGGSIHRFDERIGDFADTAAI
IERLDAVVSIDTSIAHLAGALRKPLWLMLPFAPDWRWCHDDARSPWYASAKLVRQPRPGA
WREVVEAVAEELRRG