Protein Info for ABIE53_003049 in Paraburkholderia graminis OAS925

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 7 to 329 (323 residues), 402.8 bits, see alignment E=4.9e-125 PF00108: Thiolase_N" amino acids 45 to 155 (111 residues), 39.2 bits, see alignment E=8e-14 PF08545: ACP_syn_III" amino acids 117 to 194 (78 residues), 106.4 bits, see alignment E=8.7e-35 PF08541: ACP_syn_III_C" amino acids 240 to 329 (90 residues), 129 bits, see alignment E=9.5e-42

Best Hits

Swiss-Prot: 92% identical to FABH_PARP8: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 98% identity to bgf:BC1003_2520)

MetaCyc: 50% identical to 3-oxoacyl-[acyl carrier protein] synthase 3 (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-acetyltransferase. [EC: 2.3.1.38]; Beta-ketoacyl-acyl-carrier-protein synthase III. [EC: 2.3.1.38, 2.3.1.180]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>ABIE53_003049 3-oxoacyl-[acyl-carrier-protein] synthase-3 (Paraburkholderia graminis OAS925)
MAQSTIYSRVLGTGSYLPPARVTNQDLAERLAKQGVETSDEWIVARTGIHARHFADPDVT
TSDLAQFASQRAIEAADIDPQAIDLIIVATSTPDFVFPSTACLLQNKLGIKNHGAAFDVQ
AVCSGFAYAVAMADSLIRGGQHRTALVVGAETFSRILDFNDRTTCVLFGDGAGAVILQAS
AEPGVLASALHADGSHSGILCTPGNVNGGVVAGSAFLHMDGQAVFKLAVNVLEKVAVEAL
EKANLSADQIDWLIPHQANIRIMQSTCRKLGLPQERMVVTVGEHGNTSAASIPLALDVAV
RDGRIKRGQNVLIEGVGGGFTWGASVIRY