Protein Info for ABIE53_003043 in Paraburkholderia graminis OAS925

Annotation: RNA polymerase sigma-70 factor (ECF subfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 TIGR02939: RNA polymerase sigma factor RpoE" amino acids 1 to 191 (191 residues), 326.7 bits, see alignment E=5.3e-102 PF07638: Sigma70_ECF" amino acids 10 to 187 (178 residues), 39.3 bits, see alignment E=1.4e-13 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 21 to 186 (166 residues), 118 bits, see alignment E=3.2e-38 PF04542: Sigma70_r2" amino acids 25 to 93 (69 residues), 73 bits, see alignment E=2.7e-24 PF08281: Sigma70_r4_2" amino acids 133 to 182 (50 residues), 68.8 bits, see alignment E=4.9e-23 PF04545: Sigma70_r4" amino acids 136 to 183 (48 residues), 47.4 bits, see alignment E=2.2e-16

Best Hits

Swiss-Prot: 63% identical to RPSH_PSEAE: RNA polymerase sigma-H factor (algU) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 96% identity to brh:RBRH_02621)

MetaCyc: 62% identical to RNA polymerase sigma factor RpoE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>ABIE53_003043 RNA polymerase sigma-70 factor (ECF subfamily) (Paraburkholderia graminis OAS925)
MSEKEIDQVLVERVQKGDKAAFELLVSKYHRKILRLISRLVRDPAEVEDVAQDAFIKAYR
ALPQFRGESAFYTWLYRIAVNTAKNYLATQGRRAPTSTEADAEEAETFSDADQLRDINTP
ESMLMSKQIAETVNAAMAVLPEELRTAITLREIEGLSYEEIAEMMGCPIGTVRSRIFRAR
EAIAAKLRPLLDTPEGKRW