Protein Info for ABIE53_002941 in Paraburkholderia graminis OAS925
Annotation: tRNA 2-thiouridine synthesizing protein A
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to TUSA_ALLVD: Sulfur carrier protein TusA (tusA) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
KEGG orthology group: None (inferred from 95% identity to bug:BC1001_2448)MetaCyc: 64% identical to TusA sulfur-carrier protein (Allochromatium vinosum)
2.8.1.-
Predicted SEED Role
"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)
MetaCyc Pathways
- superpathway of arginine and polyamine biosynthesis (14/17 steps found)
- L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
- putrescine biosynthesis I (2/2 steps found)
- superpathway of putrescine biosynthesis (3/4 steps found)
- superpathway of L-arginine and L-ornithine degradation (9/13 steps found)
- superpathway of polyamine biosynthesis I (5/8 steps found)
- superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (7/11 steps found)
- sulfur oxidation IV (intracellular sulfur) (2/7 steps found)
- superpathway of sulfide oxidation (phototrophic sulfur bacteria) (4/12 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.5.3.11
Use Curated BLAST to search for 3.5.3.11
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (77 amino acids)
>ABIE53_002941 tRNA 2-thiouridine synthesizing protein A (Paraburkholderia graminis OAS925) MQIQIHKEVDARGLMCPLPILRAKKALADMESGQILKVLATDPGSQRDFAAFAKQTGNEI VESSSHDKVFTFLMKRR