Protein Info for ABIE53_002839 in Paraburkholderia graminis OAS925

Annotation: putative spermidine/putrescine transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF00005: ABC_tran" amino acids 27 to 170 (144 residues), 128.7 bits, see alignment E=2.5e-41 PF08402: TOBE_2" amino acids 287 to 354 (68 residues), 24.8 bits, see alignment E=2e-09

Best Hits

KEGG orthology group: None (inferred from 90% identity to bug:BC1001_2349)

Predicted SEED Role

"3',5'-cyclic-nucleotide phosphodiesterase (EC 3.1.4.17)" in subsystem cAMP signaling in bacteria (EC 3.1.4.17)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.17

Use Curated BLAST to search for 3.1.4.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>ABIE53_002839 putative spermidine/putrescine transport system ATP-binding protein (Paraburkholderia graminis OAS925)
MTLASIPASIPITLTQCAKTFRGTRVLEPVDLRIEAGETLVLLGPSGCGKTTTLRMIAGL
ETPDAGGRIAFGNDDVTALPIEKRQVGMVFQSYALFPNLTVRGNIGYGLKIKRVPAENAR
RRIDELLAMMRLTDHADKPIDQLSGGQRQRVALARALAVEPRVLLLDEPLTALDARLRDA
LRSDMNTLLRDLGITTVYVTHDQAEAMELGDRIVVMSAGRIEQIGSPRDIYYRPANRAVA
QFVGTINRVAGERRGGMLTTIGGAVPLPSAHRDLSAQSDSTHEIFFRPEDAFLADPDHAQ
LRGLIESSAFLGERTRLTISGAAPDALFVDVAGRVELARGTPVGISIGHDALIALS