Protein Info for ABIE53_002838 in Paraburkholderia graminis OAS925

Annotation: putative spermidine/putrescine transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 45 to 74 (30 residues), see Phobius details amino acids 102 to 128 (27 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 120 to 295 (176 residues), 43.4 bits, see alignment E=1.6e-15

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 90% identity to bug:BC1001_2348)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>ABIE53_002838 putative spermidine/putrescine transport system permease protein (Paraburkholderia graminis OAS925)
MSAVVEHDAGENGKQDFSMNSITVSSQAAAGKKPRSRLRLPDSRAWLAAGQWLVTLLLCA
FLIVPVVMSILAGLTVNYFKGISSGFTLRWLGEVWTQYHGSVFLSLEVAAATLFITLLTG
VPAGYVLARSKTRLSRVIEEFLVLPIALPGLASALALLVVYGGFTMFRMSVAFIVVGHVV
FTLPFMVRAVAAVCASSDLRTLEEGAASLGASFMQRFVTIVLPNARPGIVAGALAVLTLS
IGEFNLTWMLHTPDTKTLPVGLADTYASLRIEIGSAYTILFFIMTMPLLVAMQWLGVDAT
GQRSAAKKRGAASATKSITTP