Protein Info for ABIE53_002810 in Paraburkholderia graminis OAS925

Annotation: sterol desaturase/sphingolipid hydroxylase (fatty acid hydroxylase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 105 to 243 (139 residues), 102.7 bits, see alignment E=1.1e-33

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_2324)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>ABIE53_002810 sterol desaturase/sphingolipid hydroxylase (fatty acid hydroxylase superfamily) (Paraburkholderia graminis OAS925)
MDYDEDTYDSLYWVIVGVVEVLAMYAILRPLEALRPVEQWDNRKAVRVDVIYTWIAKLGI
LNLFFFFALQPFFDNVQAWLRLHNISNIEFDNLWPGVTTQPLVTFVMYLLALDFAGYWYH
RWQHRIGVWWELHAVHHSQQQMSLWADDRNHLLDDLLQASFFAVIALVIGVPPSQFVVLV
AITNLAQSVQHANIRLHFGWLGERLLVSPTFHRRHHAIGYGHEGLKYGCNFGVLFPWWDM
LFRSVSWSREMEPTGISDQLQGRAYGEGFWAQHWLAFVRIGRRLSARRGNRDEGGATAV