Protein Info for ABIE53_002782 in Paraburkholderia graminis OAS925

Annotation: Rrf2 family iron-sulfur cluster assembly transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02010: iron-sulfur cluster assembly transcription factor IscR
  • amino acids 1 to 138 (138 residues), 216.9 bits, E=7.5e-69
• TIGR00738: Rrf2 family protein
  • amino acids 1 to 135 (135 residues), 144.4 bits, E=1.9e-46
• PF02082: Rrf2
  • amino acids 3 to 135 (133 residues), 141.1 bits, E=1.2e-45

Best Hits

Swiss-Prot: 56% identical to Y1593_NEIMA: Putative HTH-type transcriptional regulator NMA1593 (NMA1593) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 98% identity to bge:BC1002_1892)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Protein Sequence (176 amino acids)

>ABIE53_002782 Rrf2 family iron-sulfur cluster assembly transcriptional regulator (Paraburkholderia graminis OAS925)
MRLTTKGRFAVTAMIDLALRQEQGPVTLAGISQRQHISLSYLEQLFGKLRRHEIVESVRG
PGGGYNLARRAEDVTVADIIIAVDEPLDATQCGGKGSCEGTKQHDGHCMTHELWSTLNQK
MVEYLDSVSLKDLVDQQRSREGAPAVLRDRRSEAPAVEPVRVAPKGPNSVFNMAGS