Protein Info for ABIE53_002636 in Paraburkholderia graminis OAS925

Annotation: sugar phosphate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 373 to 397 (25 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 392 (365 residues), 169.3 bits, see alignment E=1.2e-53 amino acids 284 to 435 (152 residues), 42 bits, see alignment E=6.1e-15 PF00083: Sugar_tr" amino acids 56 to 403 (348 residues), 28 bits, see alignment E=1.1e-10

Best Hits

Swiss-Prot: 45% identical to NICT_PSEPK: Putative metabolite transport protein NicT (nicT) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 63% identity to cti:RALTA_B0824)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>ABIE53_002636 sugar phosphate permease (Paraburkholderia graminis OAS925)
MQSDATWSLTTSTNNLFARINWRLLPFLTLCYVFAYLDRINIGFAKLQMQADVGLSDAAY
GLGAGVFFLSYMLFEIPSNILLPKIGARRTLSRIMILWGLTSASMMFVTSANAFYVIRFL
LGVFEAGFAPGLIFYLTYWYPQNRMARAITVIMLCGPIGGIFGAPLSTGTMMLLDTVGGL
HGWQWMFIAEGLPSVLLGVFGLFWITDRPAEAKWLSDTDKRLLAAELKHDTAGNEPRHHS
FRQVVSDPRVLLLGVSYFCIICGHYTVSFWLPTILKSAGVTSTMTIGILAAIPYIAAIFA
MVWWGRRSDRLGERRWHTVSMLTLAAVALLIAALNDTSLLITIISLTVATAGLWAAYTVF
WAMPSDYMKGDTAAGGVALVNTIGLFGGFVSPTLIGYFKTLTGTMQAGLLGMVGILVIGS
LLLSFNRLPSPAGTQDLAAAEFESS