Protein Info for ABIE53_002542 in Paraburkholderia graminis OAS925

Annotation: AraC-like DNA-binding protein/quercetin dioxygenase-like cupin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF02311: AraC_binding" amino acids 33 to 149 (117 residues), 50.3 bits, see alignment E=3.1e-17 PF12833: HTH_18" amino acids 188 to 265 (78 residues), 82.6 bits, see alignment E=3.2e-27 PF00165: HTH_AraC" amino acids 228 to 264 (37 residues), 28.9 bits, see alignment 1.5e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_2201)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>ABIE53_002542 AraC-like DNA-binding protein/quercetin dioxygenase-like cupin family protein (Paraburkholderia graminis OAS925)
MTPYAGSDRSSFVSLTDTPPEFQPNEAHPIRVRSRPMPMGSHFARHQHAWAQVAYASRGV
LRVATTGTTWMVPPSRAIWVPPHVTHEVVAVEDAFLRTLYITESTVPAGLDAPRVVEVSN
LLREVIAALDTPGLSPARERLLGALALDELTRSQPLPLSVPMPNEKRLRALCEAVIADPT
PGESLEQWAASVGASTRTIARLFRQELGVSFSQWRQQAILARAIPLLSQGRPLSHVAQEL
GYQSQSAFSAMFRRAFGESPRAFIERGSEHRLENGESADDADQDEISLEQTLPTSADPIA
PGADRR