Protein Info for ABIE53_002521 in Paraburkholderia graminis OAS925

Annotation: cardiolipin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 10 to 493 (484 residues), 372.7 bits, see alignment E=1.6e-115 PF13396: PLDc_N" amino acids 18 to 59 (42 residues), 23.4 bits, see alignment 7e-09 PF13091: PLDc_2" amino acids 334 to 456 (123 residues), 104.4 bits, see alignment E=6.3e-34 PF00614: PLDc" amino acids 407 to 433 (27 residues), 22 bits, see alignment (E = 1.9e-08)

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 87% identity to bpy:Bphyt_2471)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>ABIE53_002521 cardiolipin synthase (Paraburkholderia graminis OAS925)
MQFDLLHVGTLVALAHILGAVAACHAILNTRTSQGAIAWAVSLVAMPYLTLVPYLFLGRS
KFAGYADARRVENELLRTHAHPPQWDKLASSVELPAHALGGRLVHSLTRLGGMPFLPGNA
VRTLVNGTATFEAIFDAIEHARHYIIVQFFIVREDALGEMFKEALIAKARQGVRVYFLYD
SIGSFDLPHRYVASLRAGGVDTHPFATNRLFVNRLQLNFRNHRKIVSVDGERAFVGGHNV
GVEYLGAKPPLSPWRDTHIEVRGPAVASIQFVFTEDWYWATQQLPQLDVPPMPVDSTNAS
LPASSTPAANHDMHCLVVPSGPADKQETCSLFFVEAINAARERIWITTPYLIPDEAVFSA
LRLAALRGVDVRIMIPSRRDHVVVFEASKLYAYDSLRAGIRIFRYQPGFLHQKVVLIDTV
AAAVGSANLDNRSFRLNFEIMVVTVDQSFAKEVEAMLLDDFAQSREIDRNEYRQASAVRR
VLMHVARLFSPIL