Protein Info for ABIE53_002431 in Paraburkholderia graminis OAS925

Annotation: DNA-binding NtrC family response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF00158: Sigma54_activat" amino acids 137 to 304 (168 residues), 215.9 bits, see alignment E=5.8e-68 PF14532: Sigma54_activ_2" amino acids 138 to 309 (172 residues), 68.9 bits, see alignment E=1.1e-22 PF07728: AAA_5" amino acids 161 to 280 (120 residues), 24 bits, see alignment E=6.9e-09 PF02954: HTH_8" amino acids 412 to 450 (39 residues), 39.8 bits, see alignment 6e-14

Best Hits

KEGG orthology group: None (inferred from 99% identity to bug:BC1001_1411)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>ABIE53_002431 DNA-binding NtrC family response regulator (Paraburkholderia graminis OAS925)
MRTTTKIEELDIYVWEGKADIVDRVARCMASFDVEVIRADDIAISPERTAQRPSLAIISV
SVIDSGALIVRDWQAAHGIPVVWVGAAPRDHDPSMYPAEYSHILPLDFTCAELRGMVTKL
VLQMRAHSAKTHESDAIIANSECMQALLHEVDTFADCDTSVLVHGETGVGKERIAQLLHE
KHSRYGKGPFVAVNCGAIPDGLFESLFFGHSKGSFTGAVVAHKGYFEQADGGTLFLDEIG
DLPLYQQVKLLRVLEDSAVTRIGSATPVKLDFRLVAATNKHLPQLVKDGTFRADLYYRLA
VIELKIPSLEERGAVDKIAIFKAFIAHVVGAERLAGLPDLPYWLADAVADTYFPGNVREL
RNLAERIGVTVRQIGAWDAARLQRLLALARSSQPVPAESAAEVLVDRSKWDMAERNRVIA
ALDANSWRRQDTALYLGISRKVLWEKMRKYQIFDEEPETRESE