Protein Info for ABIE53_002342 in Paraburkholderia graminis OAS925

Annotation: putative integral membrane protein (TIGR00698 family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 72 to 96 (25 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 22 to 343 (322 residues), 284.9 bits, see alignment E=3.2e-89

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_1501)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>ABIE53_002342 putative integral membrane protein (TIGR00698 family) (Paraburkholderia graminis OAS925)
MTTARLTAATAEASSARGQLNGILFVALFAAAVTRIAQIPAIAGLGLSPLIVGIVAGAIY
GNALRDGMPASWAAGVNFSARKLLRIAVAFFGLRVSLQEIAQVGLPGLAESVLIVVSTLV
IGTWAGMKIMKLDRDTALLTAAGSAICGAAAVLAFESTLQSKPHKSAMAVGSVVLFGTLS
MFLYPVLFKAGWLHLDTTGAGLFFGGTIHEVAQVVGAASNVSPEATHIATIVKMTRVMLL
VPVLLVVGLWVNRAARRDVDASSASSQQGASVQQRRPGKLAIPWFALGFLAFVVINSLHV
LPQAATSTLNTLDTFALTMAMTALGIETRISQIREAGPRALTTGFILYVWLIAGGLGITW
AVQHFFG