Protein Info for ABIE53_002303 in Paraburkholderia graminis OAS925

Annotation: cytochrome c oxidase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 147 to 176 (30 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details PF00510: COX3" amino acids 36 to 207 (172 residues), 90.1 bits, see alignment E=1.2e-29

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 86% identity to bpy:Bphyt_2028)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>ABIE53_002303 cytochrome c oxidase subunit 3 (Paraburkholderia graminis OAS925)
MSDAVNLQRSSREPREPDEPAGLLPIGSAGERSGGWWGCLTLVLTEGALFGYLIFTYLYL
ASQNPQHWPPEGLPKLTLGVVNTVILLTSSVFVWLCERCVRRRRVRWAVASMATGVVLGI
VFMGIQLAEWHDHPYGLTTHLYGSLYFTITGFHMAHVAVGIVVLLLLLIWTALGYFDERR
CAALKIGGLYWHFVDIVWLFIFSTLYLTPYLFQEWSWPRT