Protein Info for ABIE53_002193 in Paraburkholderia graminis OAS925

Annotation: peptidoglycan/LPS O-acetylase OafA/YrhL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 20 to 33 (14 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 17 to 329 (313 residues), 103.4 bits, see alignment E=6.9e-34

Best Hits

KEGG orthology group: None (inferred from 97% identity to bgf:BC1003_1681)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>ABIE53_002193 peptidoglycan/LPS O-acetylase OafA/YrhL (Paraburkholderia graminis OAS925)
MTASALPIAPSHSRRIVQLDGLRAIAVLAVFAQHALKAPLWMGVDLFFVLSGFLITGILL
ERKARGQSYFGYFYARRARRILPPYLLLMVVSSILFGFGWAQHWQWYAFFATNIGDALNQ
SGHDSLNVLWSLAVEEQFYIVWPFVILLVPERVLAWVAAALILLVPVLRAVATPWFDSFW
PIYYLTPFRMDLLAAGALLAVAVRRDRDALEPFKGLAVLGVIAALAALAWLHLHFPRFRA
ANTPLSNAGLYSISLVLCTSVVVIALQSRGIVKRLLCNPVLVYIGTISYTIYLIHLSVLY
ALWPLNMSRYVTATLALAITLAYASVTWFAFEKRLIFGSRGSSHATAGAGASVPRAAPQA
PHGRA