Protein Info for ABIE53_002166 in Paraburkholderia graminis OAS925

Annotation: TatD DNase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR00010: hydrolase, TatD family" amino acids 2 to 256 (255 residues), 276.1 bits, see alignment E=1.3e-86 PF01026: TatD_DNase" amino acids 3 to 256 (254 residues), 280.6 bits, see alignment E=5.9e-88

Best Hits

Swiss-Prot: 40% identical to Y343_BUCAP: Uncharacterized metal-dependent hydrolase BUsg_343 (BUsg_343) from Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

KEGG orthology group: K03424, TatD DNase family protein [EC: 3.1.21.-] (inferred from 95% identity to bpy:Bphyt_1942)

Predicted SEED Role

"Putative deoxyribonuclease YcfH" in subsystem YcfH

Isozymes

Compare fitness of predicted isozymes for: 3.1.21.-

Use Curated BLAST to search for 3.1.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>ABIE53_002166 TatD DNase family protein (Paraburkholderia graminis OAS925)
MFVDSHCHINFEGLADRLPQVLENMRSHAVTHALCVSVDLETLPSVLEIASRHDNVYASV
GVHPDHEDMREPSVAELVELAEHPKVVAIGETGLDYYRLEGRSIADMEWQRERFRTHIRA
AHATGKPLIIHTRSSSEDTLRIMAEERASEPGGVMHCFTEPWSVAEQALAQNFYISLSGI
VTFKSATDVQDVARRVPLERLLIETDSPYLAPVPYRGKPNEPAYVSYVGRFIAQQREMTD
EALAAATTQNFFRLFKIPAPAGA