Protein Info for ABIE53_002047 in Paraburkholderia graminis OAS925

Annotation: DNA-binding YbaB/EbfC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 3 to 104 (102 residues), 115 bits, see alignment E=7.8e-38 PF02575: YbaB_DNA_bd" amino acids 10 to 98 (89 residues), 123.4 bits, see alignment E=1.7e-40

Best Hits

Swiss-Prot: 100% identical to Y952_PARP8: Nucleoid-associated protein Bphy_0952 (Bphy_0952) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K09747, hypothetical protein (inferred from 99% identity to bxe:Bxe_A2360)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>ABIE53_002047 DNA-binding YbaB/EbfC family protein (Paraburkholderia graminis OAS925)
MMKGQLAGLMKQAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVTMTCKNDVRRVSIDPSL
LADDKDMLEDLVAAAFNDAVRKAEATAQEKMGGMTSGLPLPPGFKLPF