Protein Info for ABIE53_002021 in Paraburkholderia graminis OAS925

Annotation: dTDP-4-amino-4,6-dideoxygalactose transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01041: DegT_DnrJ_EryC1
  • amino acids 18 to 377 (360 residues), 361.8 bits, E=2.3e-112

Best Hits

Swiss-Prot: 41% identical to ARNB_SERP5: UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (arnB) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_1836)

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Arginine and proline metabolism
• Caprolactam degradation
• Lysine biosynthesis
• Lysine degradation
• Methionine metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.-

Protein Sequence (386 amino acids)

>ABIE53_002021 dTDP-4-amino-4,6-dideoxygalactose transaminase (Paraburkholderia graminis OAS925)
MTQSTVASLPFLPFVKPEIDEETIQGVADVLRSGWITTGPQNQKFEAALSEFCGGRPVRT
FNSGTATLEIGLRIADVGEGDEVITTPASWVSTSNVIYEVGATPVFADIDPVTRNIDLDK
LEQAITPRTKALIPVYLSGLPVDMDRLYAIARAHKLRVVEDAAQAFGSTWNGKRIGAIGD
MVSFSFHANKNLTSIEGGALVLNNEDEAVLAQKYRLQGITRTGFDGMDCDVLGGKYNLTD
VAARVGLGQLPHLERFLAQRRKLARAYFAGFEGGAAQKLGVGLPFADFENSNWHMFQITL
PLDKLSIDRAGFMSQLKDRGIGSGVHYPAIHLFTLYRARGFTEGMFPHAERFGATNVTLP
LFTLMNEGDVQRVCRAVNEICEQYGK