Protein Info for ABIE53_001989 in Paraburkholderia graminis OAS925

Annotation: repressor LexA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 TIGR00498: repressor LexA" amino acids 1 to 219 (219 residues), 209.9 bits, see alignment E=1.5e-66 PF01726: LexA_DNA_bind" amino acids 1 to 68 (68 residues), 88.5 bits, see alignment E=2e-29 PF00717: Peptidase_S24" amino acids 99 to 214 (116 residues), 107 bits, see alignment E=5e-35

Best Hits

Swiss-Prot: 92% identical to LEXA_PARPJ: LexA repressor (lexA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 96% identity to bug:BC1001_1866)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>ABIE53_001989 repressor LexA (Paraburkholderia graminis OAS925)
MTKLTARQQQQQQVFDLIRRAIERTGFPPTRAEIAAELGFSSANSAEEHLRALARKGVIE
LAAGASRGIRLLPSQDFGQDGTQHQFTLPHPSIMQLSLPLIGRVAAGSPILAQEHIAQHY
ACDPALFSSKPDYLLKVRGLSMRDAGIFDGDLLAVQKRSEAKDGQIIIARLGDDVTVKRL
KRRPNGIELIAENPDYENIFVETGSADFALEGIAVGLIRPGEF