Protein Info for ABIE53_001975 in Paraburkholderia graminis OAS925

Annotation: tRNA-dihydrouridine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01207: Dus
  • amino acids 1 to 295 (295 residues), 263 bits, E=1.7e-82
• TIGR00742: tRNA dihydrouridine synthase A
  • amino acids 1 to 308 (308 residues), 444.1 bits, E=1.6e-137

Best Hits

Swiss-Prot: 61% identical to DUSA_PSEPK: tRNA-dihydrouridine(20/20a) synthase (dusA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K05539, tRNA-dihydrouridine synthase A [EC: 1.-.-.-] (inferred from 94% identity to bgf:BC1003_1472)

MetaCyc: 60% identical to tRNA-dihydrouridine synthase A (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA dihydrouridine synthase A"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Protein Sequence (317 amino acids)

>ABIE53_001975 tRNA-dihydrouridine synthase A (Paraburkholderia graminis OAS925)
MMDWTDRHCRSLHRMISRHTWLYTEMVTTGALLHGDVPRHLAFTPDEAPVALQLGGSEPD
DLARSAKLGEHWGYDEINLNCGCPSERVQRGAFGACLMNEPQLVADCVKAMRDVVSVPVT
VKHRIGVDAVEEYGFVRDFVGTIAEAGCDVFIVHARNAILKGLSPKENREIPPLKYEYAY
QLKRDFPHLEIIINGGIRTLDEVETHLQHVDGVMLGREAYHNPYLLADVDARFYGSTQAP
LTREQVEAQLIEYCAAEMARGTYLGAITRHALGLYRGEAGARGWRRVLSDSKRLAARDLA
IFDEARQHLREPVEIFE